PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g48180.1.p
Common NameBRADI_3g48180, LOC100841059
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family DBB
Protein Properties Length: 259aa    MW: 27902.3 Da    PI: 4.7233
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g48180.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.52e-06446541
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                       C+ ++   ++  C  ++  lC  C +e H        H++ p
  Bradi3g48180.1.p  4 QCDSCGVAAATVVCCADEAALCGRCDVEVHAAnrlaskHQRLP 46
                      7*****999*********************6577888898877 PP

2zf-B_box27.18.6e-095586334
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                       ++C+ ++ek + +fC +++ l+C+dC + +H
  Bradi3g48180.1.p 55 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 86
                      689**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.826147IPR000315B-box-type zinc finger
CDDcd000215.89E-6347No hitNo description
SMARTSM003361.1E-8447IPR000315B-box-type zinc finger
SMARTSM003363.5E-1453100IPR000315B-box-type zinc finger
PROSITE profilePS501198.68853100IPR000315B-box-type zinc finger
PfamPF006431.5E-65596IPR000315B-box-type zinc finger
CDDcd000214.85E-75686No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010100Biological Processnegative regulation of photomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0000989Molecular Functiontranscription factor activity, transcription factor binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MKIQCDSCGV AAATVVCCAD EAALCGRCDV EVHAANRLAS KHQRLPLDAL GAGKLPRCDV  60
CQEKAAFIFC VEDRALFCRD CDEPIHVPGT LSGNHQRYLA TGIRVGFGGP VSACADADHG  120
ASHDADHHAP PMAPAAERPP AQAQQVPSPP QFLPQGWAVD ELLQFSDYES SDKLHKESPL  180
GFKELEWFTA DMELFQDQTP KGGRTAIEVP EFLNSQAADD AAYYRPSRGA ATAVVRQSKK  240
ARIEIPDDED FFIVPDLG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0092890.0BT009289.1 Triticum aestivum clone wlm0.pk0023.h3:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575316.10.0PREDICTED: B-box zinc finger protein 25-like
SwissprotQ9SID16e-73BBX25_ARATH; B-box zinc finger protein 25
TrEMBLI1IBD60.0I1IBD6_BRADI; Uncharacterized protein
STRINGBRADI3G48180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32023368
Representative plantOGRP53971020
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.18e-58DBB family protein